RalB Protein

10169

Size：100 μl Price：$ 239 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

RalB Protein

Cat. #: 10169

Product Name: RalB Protein

Synonyms: v-ral simian leukemia viral oncogene homolog B

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 23 kDa

Purity: >95% by SDS-PAGE

Introduction: The Ras-like small G proteins, RalA/B, are important components of Ras signaling pathways, implicated in the initiation and maintenance of tumorigenic transformation, as well as vesicle transport, apoptosis, transcription, cell migration, and cell proliferation.

Amino Acid Sequence (1-206)

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDIL DTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEE RRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RalB was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References: 1. Chien, Y. et al., Cell 127: 157-170, 2006. 2. Hsieh, C.-L. et al., Somat. Cell Molec. Genet. 16: 407-410, 1990

Reference citations

No data available

Product Targets

Product Categories

RalB Protein

RhoA Protein

Fascin1 Protein

Rab7 Protein

CST3 Protein

Contant Us