Rab35(Q67L) Protein

10133

Size：25 μl Price：$ 248 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Rab35(Q67L) Mutant

Cat. #: 10133

Product Name: Rab35 Protein Q67L mutant

Synonyms: Member RAS oncogene family, RAY, H-ray, RAB1C

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 23 kDa

Purity: >95% by SDS-PAGE

Introduction: The Ras super-family of small GTP-binding proteins, which includes the Ras, Ral, Rho, Rap, and Rab families, the Rab family appears to play a critical role in regulating exocytotic and endocytotic pathways. RAB35 regulates the assembly of actin filaments during bristle development in Drosophila and filopodia formation in cultured cells.

Amino Acid Sequence (1-201, Q67L)

MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGL
ERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETED
AYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab35 QL was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.

References:
1. Zhang, J. et al., Science 325: 1250-1254, 2009.
2. Zhu, A. X. et al., Biochem. Biophys. Res. Commun. 205: 1875-1882, 1994.

Reference citations

No data available

Product Targets

Product Categories

Rab35(Q67L) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us