Size:25 μl Price:$ 248 Brand:NewEast Place of Origin:USA Immunogen:
Rab4A(Q67L) Mutant
Cat. #: 10131 |
Product Name: Rab4A Protein Q67L mutant |
Synonyms: Member RAS oncogene family, RAB4, HRES-1/RAB4 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 24 kDa |
Purity: >95% by SDS-PAGE |
Introduction: The Rab family of Ras-related GTP-binding protein Rab4 is involved in bidirectional sarcolemmal-vesicular Adrb2 trafficking, which occurs continuously in healthy hearts and is necessary for normal baseline adrenergic responsiveness and resensitization after catecholamine exposure. |
Amino Acid Sequence (1-213, Q67L) |
MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGL ERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFL EASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRA QAPNAQECGC |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab4A Q67L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Barbosa, M. D. F. S. et al., Genomics 30: 439-444, 1995.
2. Odley, A. et al., Proc. Nat. Acad. Sci. 101: 7082-7087, 2004.
3. Rousseau-Merck, M.-F. et al., Hum. Genet. 86: 350-354, 1991.
4. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989.
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 [email protected] [email protected] 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase