Size:100 μl Price:$ 239 Brand:NewEast Place of Origin:USA Immunogen:
Arf6 Protein
Cat. #: 10124 |
Product Name: Arf6 Protein |
Synonyms: ADP-ribosylation factor 6 |
Source: Human recombinant, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 17 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arf6 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf6 regulates membrane trafficking and the actin cytoskeketon at the plasma membrane and functions as a regulatory molecule of phagocytosis. |
Amino Acid Sequence (13-175) |
EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYT GTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRD RNWYVQPSCATSGDGLYEGLTWLTSNYKS |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf6 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Cavenagh, M. M. et al., J. Biol. Chem. 271: 21767-21774, 1996.
2. D'Souza-Schorey, C. et al., Science 267: 1175-1178, 1995.
3. Falace, A. et al., Am. J. Hum. Genet. 87: 365-370, 2010.
4. Hernandez-Deviez, D. J. et al., Nature Neurosci. 5: 623-624, 2002.
5. O'Neal, C. J. et al., Science 309: 1093-1096, 2005.
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 [email protected] [email protected] 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase