Size:10 μl Price:$ 347 Brand:NewEast Place of Origin:USA Immunogen:
Arf1(Δ17Q71L) Mutant
Cat. #: 10123 |
Product Name: Arf1 Protein Δ17 Q71L mutant |
Synonyms: ADP-ribosylation factor 1 |
Source: Human recombinant, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 21 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
Amino Acid Sequence (1-181, Δ17, Q71L) |
MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD VGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside(DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf1 Δ17Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining |
References:
1. Amor, J. C. et al., Nature 372: 704-708, 1994.
2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989.
3. Hirai, M. et al., Genomics 34: 263-265, 1996.
4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008.
5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992.
6. Mossessova, E. et al., Cell 92: 415-423, 1998.
7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989.
8. Presley, J. F. et al., Nature 417: 187-193, 2002.
9. Renault, L. et al., Nature 426: 525-530, 2003.
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 [email protected] [email protected] 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase