Size:10 μl Price:$ 347 Brand:NewEast Place of Origin:USA Immunogen:
Cat. #: 10122 |
Product Name: Arf1 Protein Δ17 mutant |
Synonyms: ADP-ribosylation factor 1 |
Source: Human, recombinant, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 21 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
Amino Acid Sequence (1-181, Δ17) |
MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 [email protected] [email protected] 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase