Sar1a Protein

10114

Size：100 μl Price：$ 349 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Sar1a Protein

Cat. #: 10114

Product Name: Sar1a Protein

Synonyms: SAR1 homolog A, SAR1, Sara, SARA1, Masra2

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 22 kDa

Purity: >95% by SDS-PAGE

Introduction: Small GTPases are a super-family of cellular signaling regulators. Sar1 is a member of these small GTPases. Sar1 functions as a molecular switch to control protein–protein and protein–lipid interactions that direct vesicle budding from the ER.

Amino Acid Sequence (1-198)

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA
GMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGN
KIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Sar1a was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. He, H. et al., Gene Expr. 10: 231-242, 2002.
2. Jones, B. et al., Nature Genet. 34: 29-31, 2003.
3. South, S. T. et al., J. Cell Biol. 149: 1345-1359, 2000.

Reference citations

No data available

Product Targets

Product Categories

Sar1a Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us